Liste des ingrédients - France

Pays : France - Voir la liste pour les produits correspondants du monde entier

1733 ingrédients:

IngrédientProduits*
E140 162
Colorant 162
Sucre 142
Arôme 120
Glucose 93
Huiles et graisses 74
E330 71
Sirop de glucose 68
Amidon 67
Huiles et graisses végétales 63
Céréale 61
Arôme naturel 61
Fruit 61
Produits laitiers et dérivées 60
Acidifiant 60
Eau 58
Blé 57
Farine 57
E100 55
Sel 55
Farine de céréales 50
Farine de blé 50
Émulsifiant 46
E160c 45
Légume 43
E322 37
Huile végétale 35
Amidon de mais 35
Lait 34
Épaississant 33
E120 33
Stabilisant 32
Cacao 32
Agent d'enrobage 30
Huile et matière grasse de palme 30
Plant 30
Œuf 30
Légume-racine 29
Correcteur d'acidité 29
Fruits à coque 29
E500 28
Lait en poudre 28
E163 28
E150a 27
Agrume 26
Arachides 25
Huile de palme 25
Jus de fruits 25
E420 24
Gélifiant 24
Dextrose 23
E428 23
E412 23
Pomme 22
Lécithine de soja 22
Pâte de cacao 22
Beurre de cacao 22
Graine 21
Minéraux 21
Soja 21
Fructose 21
Édulcorant 21
E414 20
Amidon modifié 20
E162 20
Amande 20
Citron 20
Riz 19
E407 19
E415 19
Protéine 19
Épice 19
Fruit rouge 19
Sauce 19
Sésame 17
Sauce au soja 17
Levure 17
Maltodextrines 17
Lait en poudre écrémé 17
Amidon de tapioca 17
Amidon de froment 17
Lactose 17
Graisse 17
Matière grasse lactique 16
E140i 16
E410 16
Matière grasse butyrique 16
E161b 15
Arôme vanille 15
Poudre de lait écrémé 15
Poivron 15
Fruits des bois 15
E950 15
Sucre inverti 15
Algue 14
E903 14
Arôme naturel de vanille 14
Sirop de glucose-fructose 14
Huile de coco 14
Menthol 13
Conservateur 13
E450 13
E440a 13
Ail 13
Matière grasse végétale 13
Graine de sésame 13
Poudre de cacao 13
Crème 13
Antioxydant 13
E141 13
Arômes naturels de menthe 13
Arôme de menthe 13
E953 13
E296 13
Animal 12
E300 12
Protéine animale 12
Blanc d'œuf 12
Poudre à lever 12
Protéine de lait 12
complexes-cuivre 12*
Pistache 12
E422 12
Petit-lait 11
Humectant 11
E901 11
Extrait 11
Rapeseed oil 11
Oignon 11
Poudre de levure 11
Amidon de pommes de terre 11
Ananas 11
Arôme naturel de citron 11
Jus de citron 11
Vanille 10
E171 10
E955 10
Poudre de cacao maigre 10
E471 10
Beurre 10
E401 10
Maïs 10
E904 10
Herbe 10
Lécithine de tournesol 10
Sirop de sucre 10
Cuivre 10
Citron vert 10
Sodium 9
Cassis 9
E160 9
Amidon transformé de maïs 9
Citrate de sodium 9
Sirop de sucre inverti 9
Farine de riz 9
E332 9
Orange 9
Purée 9
Huile de tournesol 9
Huile de colza 9
E133 9
Chili 8
Carotte 8
Fibre 8
Porc 8
E1400 8
E202 8
E500ii 8
Jaune d'œuf 8
E341 8
Chocolat 8
Framboise 8
E951 7
Cérise 7
Fibre végétale 7
E1510 7
Moutarde 7
Arôme naturel de citron vert 7
Wasabi 7
Protéines végétales 7
Noix de coco 7
E153 7
Fraise 7
Farine de mais 7
Gélatine de porc 7
Lactosérum en poudre 7
Noisette 6
E270 6
E101 6
Antiagglomérant 6
Miel 6
Fibres d'ananas 6
Graisse végétale de palme 6
Amidon modifié de tapioca 6
Palme 6
Jus de citron vert 6
Koji 6
E503 6
Arôme naturel d'eucalyptus 6
Légumineuse 5
E160a 5
Extrait de réglisse 5
Réglisse 5
E551 5
Vinaigre 5
Pois 5
Bœuf 5
el-00 5*
Sirop d'amidon 5
E450i 5
Poisson 5
alimentaire 5*
Écorce de citron 5
Kiwi 5
Jus concentré de fruits 5
Carthame 5
d-eucalyptus-et-du-melange-de-13-plantes-ricola 5*
E1404 5
Sirop d'amidon de maïs 5
Lait demi-écrémé 5
Sirop de glucose déshydraté 5
E150 5
Lait entier 5
E960 4
E476 4
Lait écrémé réhydraté 4
Extrait naturel de vanille 4
E150d 4
Oignon en poudre 4
E327 4
Sucre de canne 4
E503ii 4
Poudre de piment 4
Huile et matière grasse de palmiste 4
extrait-de-piment-rouge 4*
naturels 4*
Gélatine de bœuf 4
Purée de fraise 4
suiker 4*
Sulfite 4
Vitamines 4
Vitamine B6 4
Huile de noisette 4
Fromage 4
Maltodextrine de maïs 4
Extrait de pomme 4
Malt d'orge 4
Gluten 4
creme-d-amandes 4*
Malt 4
Chocolat blanc 4
E375 4
Sirop de caramel 4
Protéines de pois 4
E331 4
Huile de palmiste 4
Extrait de vanille 4
Jus concentré de citron 4
Huile 4
Jus de citron à base de concentré 4
E262 3
Persil 3
gelatine-alimentaire 3*
E967 3
E160b 3
Purée de pomme 3
el-33 3*
Courge 3
E965 3
Pomme de terre 3
Lactose et protéine de lait 3
sirop-de-tapioca 3*
Thiamine 3
el-60c 3*
Chlorhydrate de pyridoxine 3
Vitamine D 3
Basilic 3
Poudre d'ail 3
Menthe 3
aloe-vera-gel 3*
matieres-grasses-vegetales-de-coco 3*
extrait-de-spirulina 3*
plantaardige-vetten 3*
Arôme naturel d'orange 3
Protéine végétale hydrolysée 3
Petits pois 3
Ingrédient 3
Pâte de pistache 3
tarwebloem 3*
Protéine hydrolysée 3
zout 3*
Eau gazeuse 3
Radis 3
Céleri 3
Crustacés 3
Agent de charge 3
E140ii 3
E325 3
Mangue 3
Paprika 3
Fruits de mer 3
Extrait de levure 3
Huile de citron 3
Extrait de malte d'orge 3
Spirulina 3
Caroube 3
Chocolat noir 3
jus-de-citron-vert-a-base-de-jus-concentre-de-citron-vert 3*
Protéines de pois hydrolysées 3
Betterave 3
E141ii 3
Sirop de glucose de blé 3
Kirsch 3
Café 3
Myrtille 3
carbonate-de-sodium-e500 2*
E451 2
E418 2
E952 2
l-isoleucine 2*
l-valine 2*
h 2*
z 2*
c 2*
antocianinas 2*
Jus de cassis 2
Mollusque 2
Amidon de riz 2
paprikaextrakt 2*
ni-aromes-artificiels 2*
E170 2
Melon 2
Pastèque 2
Banane 2
Purée de fruits 2
Graines de chanvre 2
Gingembre 2
eucalyptus 2*
concentre-de-fruits-et-preparation-d-extrait-vegetal 2*
Culture bactérienne 2
Ferment 2
Ferment lactique 2
Lait de vache 2
esters-lactiques-des-mono-diglycerides-d-acides-gras 2*
Tournesol 2
Blanc d'œuf en poudre 2
Jus de betterave 2
Jus de betterave concentré 2
chlorophylle-e141 2*
Arôme naturel de basilic 2
Huile d'olive vierge 2
Huile d'olive 2
Huile d'olive extra vierge 2
Huile de soja 2
teneur-totale-en-sucres 2*
contiant-de-la-moutarde 2*
sal 2*
Pulpe de citron 2
Gousses de vanille bourbon 2
Amande en poudre 2
e140-e153 2*
beurre-sale-d-isigny-a-o-p 2*
arome-de-cannelle 2*
Sel marin 2
oryza-sativa 2*
kan-sporen-bevatten-van 2*
Colorant naturel 2
Sirop de fructose 2
Condiment 2
Volaille 2
E306 2
E445 2
Eau filtrée 2
Curcuma 2
Sirop de sucre caramel 2
Vanille bourbon 2
Pâte d'amande 2
extrait-de-spiruline 2*
preparation-de-morceaux-de-pomme 2*
Vanille bourbon naturelle en gousse 2
Protéine de soja 2
energie 2*
Lait entier en poudre reconstitué 2
E200 2
kleuren 2*
E334 2
Vinaigre de vin 2
contient 2*
Zinc 2
E1103 2
Jaune d'œuf liquide pasteurisé 2
noten 2*
el-63 2*
Sirop de glucose de blé en poudre 2
Sirop 2
pepites-au-citron 2*
Fleur de sel 2
arome-de-beurre 2*
Vinaigre de vin blanc 2
Arôme de pêche 2
Fleurs de carcadé 2
Carotte noire 2
Whisky 2
el 2*
E172 2
glansmiddel 2*
sel-ammoniac 2*
emulgator 2*
maiszetmeel 2*
raapzaadolie 2*
magere-cacaopoeder 2*
glucosesiroop 2*
arome-naturel-de-fleur-de-sureau 2*
E460 2
i 2*
spirulinaxtract 2*
colorante 2*
Mûre 2
roggebloem 2*
Pois croquants 2
gist 2*
karmijn 2*
lecithinen 2*
magere-melkpoeder 2*
Brisures de crêpe dentelle 2
Suc de réglisse 2
kurkumin 2*
Avoine 2
j 2*
E641 2
Piment rouge 2
E406 2
E621 2
Fer 2
Pêche 2
Arôme naturel de pomme 2
grain-de-cafe-en-chocolat 2*
E553b 2
Lait écrémé reconstitué 2
Cacao maigre 2
Gousse de vanille 2
E466 2
extrait-d-epinard 2*
Champignon 2
Huile essentielle de menthe 2
Huile essentielle 2
Calcium 2
Lait condensé 2
Farine de graines de caroube 2
ingredientes 2*
E350 2
Sureau 2
Épinard 2
Baie de sureau 2
Farine de seigle 2
Sucre brun 2
E131 2
Jus d'orange 2
Sucre liquide 2
Concentré 2
Zeste d'orange 2
eclats-d-amande-et-de-pistache-caramelisees 2*
d-eucalyptus-et-du-melange-de-13-herbes-ricola 2*
acesulfame­k 2*
Jus de pomme 2
Extrait de carthame 2
masse-de-cacao-maigre 2*
fruits-et-vegetaux-naturels 2*
el-600 2*
jus-de-citron-vert-a-base-de-jus-concentre-et-pulpe 2*
Crème liquide 2
E417 2
k 2*
eau-de-fleur-d-oranger 2*
ingredienten 2*
Œuf entier 2
Jaune d'œuf liquide 2
voedingszuur 2*
Raisin 2
Concentré de spiruline 2
natriumcarbonaat 2*
pepites-au-citron-vert 2*
Raifort 2
Piment doux 2
puree-de-citron-jaune 2*
gianduia 2*
Figue 2
Fleur de sel de Guérande 2
Sel de Guérande 2
pate-de-cafe 2*
creme-fraiche-d-isigny-a-o-p 2*
E341ii 2
Chocolat au lait 2
Saccharose 2
Sel iodé 2
concentrated-fruit-juices 2*
eviter-le-contact-avec-les-yeux 1*
tenir-hors-de-la-portee-des-enfants 1*
E307a 1
cocos-nucifera 1*
caesalpina-spinosa-gum 1*
neetle-leaf 1*
sodium-benzoate-lactic-acid 1*
trisodium-ethylenediamine-disuccinate 1*
decyl-glucoside 1*
sodium-chioride 1*
es:trigliceridos-de-cadena-media 1*
es:de-eucalipto-y-de-hierbas-ricola 1*
E420ii 1
de:bijenwas-wit-en-geel 1*
de:schellak 1*
de:karmijn 1*
de:cacaovulling-en 1*
de:hera-de-noix-et-de-cacahuètes 1*
de:palmiste 1*
de:minimum-dans-le-chocolat 1*
de:cacao 1*
de:ener-bienenwachs-weiß-und-gelb 1*
de:camaubawachs 1*
de:uberzugsmittel 1*
chlorophyllin-copper-complex 1*
de:echtes-kamin 1*
de:zuurteregelaar 1*
de:lucosesiroop 1*
de:kj 1*
de:kleurstoffen 1*
de:emulgator-midde-lecithinen 1*
de:verdikkingsmiddel 1*
de:volle-melkpoeder 1*
de:apr-gee 1*
de:suikergecoate-chocoladedra 1*
de:zout 1*
de:geheel-gehard 1*
de:plantaardig-vet 1*
de:correcteur-d-aciditė 1*
de:cire-de-camauba 1*
de:sirop-de-glucose 1*
de:anthocyanes 1*
de:curcumi 1*
de:épaississant 1*
de:mæt-carbonates-de-sodium 1*
parfum 1*
de:poudre-à-lever 1*
de:amidon-de-pomme-de-terre 1*
de:palmpit 1*
de:poudre-de-cacao 1*
de:lactosérum-en-poudre 1*
de:graisse-davor-végétale 1*
de:sucre 1*
Farine de soja 1
de:sel 1*
de:matio-weizenmehl 1*
sans-tensioactif-sulfate-reconnues-pour-leurs-proprietes 1*
de:ganz-gehärtet 1*
Matière grasse de noix de coco 1
Orge 1
fabrique-en-coree-du-sud 1*
lecithine-de-saja 1*
citronellol 1*
batonnets-de-pistaches 1*
Airelles 1
de:émulsifiant 1*
poudre-a-biscuit 1*
ingredkents-farine-de-ble 1*
de-l-ingredient-utilise-est-a-cote-de-la-date-de-durabilite-minimale 1*
de-preference-avant 1*
le-symbole 1*
selon-le-gout-du-produit 1*
le-carbone-vegetal 1*
l-extrait-de-poivre 1*
f 1*
des-pigments 1*
Caféine 1
pour-le-gout-du-cola-xplosion 1*
de:lait-complétement-en-poudre 1*
infusion-et-alcoolat-de-thym-et-autres-plantes-de-provence 1*
china-conswrvar-l-abri-de-la-chalaur 1*
e150-traces-possibles-de-fruits-a-coqua-de-moutarde 1*
amidan-de-tapioca 1*
Minéraux du lait 1
en:natural-lemon-flavouring-with-other-natural-flavourings 1*
en:lime-oil 1*
linaiool 1*
chlorophylles-complexes-cuyiques 1*
nous-pouvons-deja-vous-garantir-qu-au-moins-500 1*
2-sirop-de-glucose-fructose 1*
de:gomme-arabique 1*
de:poudre-kohle-de-lactosérum 1*
carragoeen 1*
ni-winegums-ingredienten 1*
uberzugsmittel 1*
geliermittel 1*
glukosesirup 1*
zutaten 1*
huile-de-noix-de-cl 1*
kosolie-dit-product-kan-sporen-van-tarwc-gluten-ligt-onder-de-drempelwaarde-van-glutenvrifdieet 1*
acidity 1*
modyfikowana-skrobiaz-pioki 1*
pieprzmielony 1*
wodorosty 1*
bi-nasiona-sezamu 1*
woda 1*
maka-ryiowa 1*
powlekane-orzeszkew-ziemnych-i-groszek 1*
en:flour-wheat-flour 1*
mieszanka-krakersy-ryiowe 1*
pl 1*
E635 1
819 1*
olej-palmowy 1*
aradlides 1*
agc-903o 1*
de-patata-096 1*
confiserie-colorante 1*
chloron-extracti-anthocyanins 1*
de-maiz 1*
e141-curcumine 1*
acide-sorbique-conservateur 1*
pyrophosphates-e450 1*
arome-chanvre 1*
eau-potable 1*
acetate-de-sodium-e262 1*
amidon-de-mais-modifie-e415 1*
Rapeseed 1
nvert-sugar-syrup 1*
frui-and-vegetable-concentrates 1*
sorbet-citron-saveur-citron-vert-8-8-teau 1*
nejamais-recongele-un-produit-decongele 1*
stabiisants 1*
jus-ananas-base-de-concentre-2096 1*
de:cornets-croustillants-fourrés-au-composition-délicatement-fondante 1*
Sirop de glucose de maïs 1
Jus d'orange à base de concentré 1
sorbet-a-l-orange 1*
garder-dans-un-endroit-frais-et-sec 1*
carantho 1*
michroma-curcumin 1*
extrait-de-carmin 1*
cocoa-min 1*
natural-coffee-flavor 1*
may-contain-traces-of-other-nuts-and-peanuts 1*
e140-g-5-pakjes 1*
kan-ei-en-sesam-bevatten 1*
de:aardappelzetmeel 1*
beta-caroteen 1*
kleurstof 1*
mqka-pszenna 1*
tarwegluten 1*
gemoute-tarwebloem 1*
emulgatoren 1*
rendez-vous-sur-www-cartedor-fr 1*
cacaoboter 1*
gedeeltelijk-omhuld-met-melkchocolade 1*
biscuits-met-chocoladestukjes 1*
isomalt-sucralose 1*
chlorophylle-e140 1*
de:davo-shellac 1*
Extrait d'épice 1
aspartame-e951 1*
sorbitol-e420 1*
de:arabische-gom 1*
glycerides-et-esters-polyglyceriques-d-acides-gras 1*
pays-bas 1*
skladniki 1*
Jus de raisin 1
Jus de raisin concentré 1
bcaa-acides-amines-ramifies 1*
extrait-du-melange-de-13-plantes-ricola 1*
arome-narutel-d-eucalyptus 1*
eioo 1*
406 1*
preservatiye 1*
natural-and-nature-identicol-flayours 1*
kiwi-juice-concentrate 1*
miel-7-acide-ascorbique 1*
preparation-a-base-d-aloe-vera-ungredients-aloe-vera-gel 1*
indicazioni 1*
m-carbon-ve-bcaa-xplode-powder-integratore-alimentare-di-amine-szone-di-aminoacidi-ramificati-dj-alta-c-amina-b6-che-contribuions-uient-al-vallla-icu-aanaticamento 1*
l-leuoine-1n-icejosa-sooica 1*
porcion-al-dia 1*
tomar 1*
No1 1*
l-valina 1*
l-leucina 1*
a-consommer-de-prefence-a-bcaa-kplode-powder-complemento-alimenticio-a-base-de-aminoacidos-de-cadena-ramificada-compleja-en-polvo-coneduloras-composicion-de-alta-calidad-de-aminoacidos-de-cadena-ramificada 1*
de:farine-de-froment 1*
E160aii 1
una-dieta-variata 1*
extracto-de-pimenton 1*
curcumina 1*
clorofilas-y-clorofilinas 1*
dinatriumdifosfaat 1*
el-componente-utilizado-se-encuentra-al-lado-la-focha-da-duranin-minima-lonsumi-preferentemene-of-al-batente-v-g 1*
antiaglomerantes-fostauts-de-rdeantn-gel-simnbolo-de-sabor-del-producto 1*
con-100-ml-di-acqua 1*
edulcorantes-acesulfamo-k 1*
ecorces-de-cedrats 1*
sabor-xplosion-cola 1*
pueden-aparecer-posos 1*
ni-durante-periodos-prolingats-s-comtro-medico 1*
advertencia 1*
se-recomienda-seguir-una-dieta-equilibrada-y-un-estilo-de-vida-saludable 1*
no-exceder-la-dosis-diaria-recomendada-los-complementos-alimeno-iarse-como-sustitutos-de-una-dieta-equilibrada 1*
en-proporcion-de-2 1*
du-composant-utilise-se-trouve-a-cote-de-la-date-de-durabilite-minimale 1*
le-code 1*
carboxymethylcellulose-de-sodum-cn-ments-aimentaires-doivent-etre-utilises-dans-le-cadre-d-un-mode-de-vie-sain-et-ne-pas-etre-utilises-comme-substituts-d-un-regime-ainenle-meange-dacides-amines-a-chaines-ramifiees 1*
agents-de-cuisson 1*
equililbrata-ed-urn-s-ce-soc 1*
l-glutamine 1*
des-depots-peuvent-se-creer 1*
tenir-hors-de-portee-des-enfants 1*
consommer-directement-apres-preparation 1*
et-bien-apres-l-entrainement-et-avant-de-se-coucte-apde-posethea-20m 1*
de:arômes-naturels 1*
prendre-1-portion-par-jour 1*
suivant-les-proportions-te-21-s-de-l-gutamine-et-de-la-vitamine-b6-qui-contribue-a-reduire-la-fatique 1*
vitamina-c 1*
acido-fumarico 1*
amendoim 1*
frutos-de-casca-rija 1*
pode-conter-soja 1*
contem-umafonte-de-fenilalanina 1*
Extrait de piment 1
e-corantes 1*
edulcorantes 1*
antioxidante 1*
skrobia-z-tapioki 1*
sulfitos 1*
reguladores-de-acidez 1*
maltodextrina 1*
contem-edulcorantess-ingredientes 1*
preparado-em-pe-para-gelatina-light-com-sabor-a-frutos-vermelhos 1*
truffe-blanche 1*
Lait de vache entier 1
de:coco 1*
Lait de chèvre 1
Armagnac 1
foie-gras-de-canard-en-morceau 1*
xanthano 1*
esss 1*
beurre-noisettes 1*
de:kopercomplexen-van-chlorolylen-en-chlorofylinen 1*
Saumon 1
jaune-dtoeuf 1*
Fromage de chèvre 1
Épaississant gomme arabique 1
Viande de canard 1
Viande de volaille 1
l-isoleucin-ecteurs-d-acidite 1*
Magret de canard 1
en:plain-chocolate 1*
foie-gras 1*
cire-de-candilla 1*
de:tarwebloem 1*
glycerine-vegetale 1*
Poivron jaune 1
pate-de-curry-vert 1*
peau-de-raisin 1*
prepare-dans-un-atelier-et-sont-utilises 1*
proteines-de-scia 1*
Protéine d'œuf 1
curry-vert 1*
Viande 1
irinatriumcitraat 1*
inqredients 1*
en:lime-juice-powder 1*
pepites-de-chocolats-blancs 1*
Graines de cumin 1
de-vitamine-bs-et-de-oufamvine-awe-eicorants-un-melange-dacides-amines-a-chaines-ramifiees-de-haute-qualite 1*
en:cardamom 1*
en:blanched-peanuts 1*
ebi 1*
locust-bean-un 1*
en:chilli-lime-seasoning 1*
de:peut-contenir-des-traces 1*
en:sal-and-shea 1*
en:chilli-and-lime-flavoured-cashews 1*
i-amidon-de-mais-mdifie 1*
Vinaigre d'alcool 1
mentie-congelee 1*
el-oc 1*
carnaubawachs 1*
s-5zneseeds-seaweedt-chilli-powder-colouring 1*
Maltose 1
E470b 1
chlorophyll-extract 1*
Noix de cajou 1
bijenwas 1*
melkzuur 1*
acide-lactique-adde-vegetales 1*
cera-d-api 1*
agente-di-rivestimento 1*
palma 1*
acqua 1*
hero 1*
rundergelatine 1*
conserver-dans-un-endroit-frais-et-sec 1*
kuhlundtroden-m 1*
de:citroenzuur 1*
de:cacaomassa 1*
de:dioxyde-de-titane 1*
E505 1
ingredients-en-et-sec 1*
Pulpe de noix de coco 1
Noix de coco séchée 1
sucralosa 1*
yeastextract-powder 1*
minced-galangal 1*
spearmint-leaf 1*
garlic-pue-sugar 1*
astl-water 1*
le-brevet-v-bleu 1*
en:tapioca-starch-baked-salted-peanuts 1*
de:enrobes-de-sucre 1*
concentre-couleur-de-spiruline 1*
que-no-afecta-a-la-calidad-y-el-efecto-del-producto 1*
de:packed-in-protective-atmosphere 1*
de:may-contain-traces-of-other-nuts 1*
genlian 1*
rijstbloem 1*
Œufs d'élevage au sol 1
8-de-nos-fruits-sont-issus-de-l-agriculture-durable 1*
de:sulphur-dioxi-de 1*
de:hoseradish 1*
ld-eau-et-agiter 1*
de:mustard-oil 1*
Fève de soja 1
de:wasabi-flavor 1*
de:burned-sugar 1*
de:es35 1*
Sauce soja en poudre 1
de:es08 1*
de:spice-extracts-acdity-regulator 1*
de:green-peas 1*
de:incredients 1*
machez-apres-avoir-mange-et-bu 1*
2400 1*
cyrcumine 1*
van-melk 1*
contient-de-ia-iecithine-de-soja 1*
weipoeder 1*
E965ii 1
ciclamatos 1*
mannitol-witol 1*
de:birned-sugar 1*
E501 1
de:cire-d-abeille-blanche-et-jaune 1*
acido-citrico-e-citrato-de-sodio 1*
almidon-de-maiz 1*
eracea 1*
de:et-dragées-au-chocolat-fett 1*
brassica-o 1*
as-de-cardo-mariano 1*
fosfato-dicelcico 1*
gt 1*
extracto-de-rebano-negro 1*
white-chocolate-lemon-taste 1*
reconocido-en-cinarina 1*
ymus 1*
chunks-de-chocolat-blanc 1*
Saumon fumé 1
c-sco 1*
amidodi-mais 1*
extracto-de 1*
mattodextrina 1*
Griotte 1
glucosestroop 1*
a-contribuye-a-la-sintesis-normal-de-la-cisteina 1*
vitaminas-b3-b6-y-zinc 1*
hydroxypropy-guar-hydroxypropyltrimonium-chloride 1*
de:glansmiddelen 1*
pour-en-savoir-plus 1*
cistina 1*
Anchois 1
metionina 1*
complemento-alimenticio-a-base-de-plantas 1*
poids-net 1*
E464 1
emutsifiant 1*
extrait-de-racine-de-radis-noir 1*
llay-contain-peanuts-and-nuts 1*
clorofila 1*
agents-de-filmage 1*
ascorbic-acide-natural-sweetness-flavourings 1*
Gluconate de zinc 1
E433 1
l-methionine 1*
brassica-oleracea 1*
dose-en-sylimarine 1*
oeuf-co 1*
lactate-de-sodium-0 1*
oxyde-et-hydroxyde-de-fer-o 1*
naredients 1*
brochette-chat-poids-net-55g-e 1*
sorbate-di-potassium 1*
ma 1*
chlorophylles-e-cuivre 1*
500ml-e-date-de-production 1*
de:f-lecithinen 1*
chlorophylles-et-chlorophyllines-une-consommation-excessive-peut-entrainer-des-effets-laxatifs 1*
graines-de-sesame-poids-net 1*
allergenes 1*
Lait pasteurisé 1
sans-ogm-inaredients 1*
ns-gluten 1*
a-de-la-gel-pas 1*
a-co-iserver-dans-un-endroit-sec-et-sans-odeur 1*
E211 1
sucre-de-aromes 1*
2-au-moins-50-de-ces-fruits-sont-issus-de-l-agriculture-durable 1*
aloe-barbadensis-extract 1*
methilceltulose-pectines-farine-de-graines-de-caroube 1*
hamamelis 1*
Thym 1
ble-sel 1*
ne-pas-donner-aux-ieunes-enfants-risque-d-etouffement 1*
dose-en-cynarine 1*
e140-el-60c 1*
amidon-nodifie-de-tapioca 1*
caramelised-qurnn-chlld 1*
enrobage-de-sauce-a-la-menthe 1*
dloeuf-et-de-fruits-a-coque 1*
dlarachide 1*
Lait écrémé concentré 1
enrobage-chocolat-noir 1*
glace-a-la-menthe 1*
Ail séché 1
Oignons déshydratés 1
Lait en poudre demi-écrémé 1
E235 1
carmnin-indigo 1*
lysozyme-dloeuf 1*
Agent de coagulation 1
te 1*
de:colorants 1*
E1505 1
pommes-caramelisees 1*
Agent moussant 1
Beurre de karité 1
elabore-partir-de-lait 1*
conseils-de-conservation 1*
Arôme naturel de café 1
E339 1
Fibre d'agrume 1
preparation-en-poudre-a-base-de-blanc-d-oeufs 1*
pistaches-vertes 1*
caramelisees 1*
chocolat-de-couverture-noir 1*
Pâte de noisette 1
biscuit-finement-emiette-1 1*
glacage-opera-1 1*
Garniture 1
chocolat-aux-noisettes 1*
2-salawess-chocsla-12-petits-fours 1*
aromes-naturel-de-fleur-sureau 1*
Morceaux de pomme 1
Glaçage 1
amidon-modifie-de-mdis 1*
sorbet-pomme-avec-morceaux-de-pomme 1*
les-exprimes-sur-l-ensemble-du-contenu-de-l-emballage 1*
billes-en-sucre-multicolores-1 1*
glace-au-chocolat-22 1*
poudre-de-lactoserum-contient-lait 1*
sirop-de-glucose-fructoseplait-ecreme-rehydrate 1*
glace-a-la-fraise-26 1*
arome-naturel-de-vanille-0-7-comeres 1*
agente-de-carga 1*
glace-a-la-vanille-49 1*
E304 1
sulfites-e220 1*
antes-de-comer-o-de-entrenar-o-despues-del-entrenamiento-o-antes-de-dormic-aiadir-2porion-eaoty-a-100mi-de-agua 1*
Glucose de blé 1
angelique 1*
beurre-aop-charente-poitou 1*
Poulet 1
arachide-9-sauce-sola 1*
avant-le-repas-et-avant-un-entrainement 1*
huile-de-raifort 1*
pois-vert 1*
conditionnees-en-france 1*
matieres-premieres-d-importation 1*
huile-de-toumesol 1*
melkvet 1*
Graine de courge 1
conato-de-zinc 1*
Poivre noir 1
de:bei-raumtemperatur-und-trocken-lagem 1*
siuerungsmittel-aromen 1*
de:mix-with-chilli-and-asian-flavored 1*
Fromages de brebis 1
Thon 1
e133-palentato-v 1*
extrait-de-citronnelle 1*
chocolat-de-couverture-de-couleur-foncee 1*
dicalcium-citrate-phosphate 1*
graines-de-sesames-maltodextrine-de-mais-algues-sechees 1*
de:lécithine-de-tournesol 1*
180c 1*
extrait-de-yuika 1*
da-crustaces 1*
agefls 1*
acide-acidifiant 1*
la-vitamina-b6-ayuda-a-disminuir-el-cansancio-y-la-fatiga 1*
fosfato-tricelcico 1*
ananas-comosus 1*
verdikkingsmiddel 1*
ingredients-huile-colza 1*
extrait-d-ortie-et-d-epinard 1*
gy-max 1*
cacaomassa 1*
Maltose syrup 1
ingradiants 1*
de:cacaoboter 1*
frangon-crongon 1*
contient-de-l-arachide 1*
poudres-de-maigre 1*
betanina 1*
contient-une-sotjrce-de-phenylalanine 1*
magere-melkpoeder-volle-melkpoeder 1*
leaf-extract 1*
chlorofylen-en-chlorofylinenj-bietenrood 1*
geliliarlf-chlorophylles 1*
natriumstearoyt-2-lactylaat 1*
mono-en-diolycerjden-van-vetzuren 1*
gomme-diacacia 1*
Romarin 1
en-poudre 1*
extrait-de-oaprika 1*
E481 1
mono-diglycerides-dacides-gras 1*
ongredients-purifhie-158-eau-hemelle-frais-33-fructose-37-1-miel 1*
Extrait de légumes 1
gleen-birdseye-chillies 1*
citrus-limon 1*
h-clorofille-e-cloroftilline-curcume-dorvor-met0s-ca-vaone-del-prodti0-da-cons-mabone-vegelale-denuticare-g-inoredienti-utilati-in-cia-caa-lode-onmder 1*
carageenan 1*
issu-du-lait 1*
bevat-mejk 1*
pestp-11-lactoserum-en-poudre 1*
iant 1*
de-la-ha-i-na-11 1*
Pâte de crevettes 1
E132 1
de:natriumcarbonaten 1*
ceufs 1*
cukier 1*
eclats-de-caramel-dl-isigny 1*
c75810 1*
tflsoddm-citrate 1*
acida-ascorbique 1*
Tomate 1
natuurlijk-vanillearoma 1*
e140-e150a 1*
blueberryj-strawberry 1*
piment-en-pou-dre 1*
a-l-eau-parfum-pomme 1*
con-coloranti-di 1*
e171-beurre 1*
controllare-la-lette-indaco 1*
de:coated-peanuts-and-wasabi-flavored-peas 1*
poudre-de-wrsabi-l 1*
matieres 1*
Jus de cerise 1
arome-naturel-de-piment-de-cayenne 1*
de:garlic-hydrolyzed-soy-protein 1*
poudre-de-wasabi-0-37 1*
carotene-naturel 1*
praline-noisettes-e407 1*
no-recomendado-su-consumo-para-mujeres-embarazadas-o-en-periodo-de-lactancia 1*
l-cistina 1*
t-ifosiaten 1*
Thé vert 1
beta-alanine 1*
produit-importe 1*
limonene 1*
en:product-contains-the-equivalent-of-3-lime-juice-and-2-5-lemon-juice 1*
huile-essentielle-de-romarpn 1*
Graisse de palmiste 1
Thé 1
de:melk 1*
culture-de-kombucha 1*
sos-sojowy 1*
Iode 1
E301 1
proteines-de-riz 1*
arome-naturel-da-basilic 1*
dicalcium-phopshate 1*
Chlorure de chrome 1
Jus d'ananas concentré 1
de:minstens-25-in-het-ewe-chocolade-gedeelte 1*
Chrome 1
Lactosérum doux 1
d-oeuf-et-de-fruits-a-coque 1*
Gaz propulseur 1
Folate 1
cyanocobalamir 1*
Vin rosé 1
Vitamine B12 1
carbonate-acide-dlammonium 1*
stearoyl-2-iactylate-de-sodium 1*
de:sojameel 1*
substance-aromatisante-naturelle 1*
Vitamine A 1
pyrophosphate-e450 1*
rouge-de 1*
de:kul-ne 1*
hydrolizowane-biatko-roslinne 1*
cacaom-en-poudre 1*
sorbate-da-potassium 1*
Chlorhydrate de thiamine 1
une-onsommation-excessive-peut-avoir-des-effets-laxatifs 1*
es:contiene-una-fuente-de-fenilalanina 1*
Antimoussant 1
xanthaanqom 1*
de:kokos-und-palmkem 1*
fr 1*
huile-de-menthe 1*
ammoniumwaterstofcarbonaat 1*
spiruliu-platensis 1*
acesuifame-k 1*
Papaye 1
Marinade 1
de:complexes-cuivre-chlorophylles-et-cuivre-chlorophyllines 1*
lait-ecreme-en-poudre-sirop-de-glucose-de-ble-en-poudre 1*
E482 1
Molybdate de sodium 1
en:raifort-deshydrate-farinede-moutarde 1*
chlorophylls-and-chlorophylline-with-copper 1*
sorbitc 1*
Molybdène 1
Piment de Cayenne 1
Oxyde de zinc 1
celulosa-microcristalina 1*
eau-sel 1*
aceite-de-d-alpha-tocopheryle 1*
zonder-geharde-vetten 1*
de-l-indigo 1*
el-producto-esta-disenado-especialmente-para-personas-activas-y-deprist-daria-recomendada 1*
60-comprimes-de-1030-mg 1*
kokos 1*
amidon-de-tapioca-arachides 1*
Fibre d'avoine 1
Inositol 1
vltamineb5 1*
de:anthocyanen 1*
Thé noir 1
E530 1
preparation-de-wasabi 1*
pruifpuree-encentrates 1*
valeur-nutriuve-pour 1*
melange-americain-de-muffins 1*
natriumwaterstofcarbonaat 1*
aspartame-eacessulfame-k 1*
de:egg-powder-flavor 1*
amandes-sucre 1*
prepare-avec-doids-total-365-g-de-prunelle-de-coree-19-en-ducre 1*
Biotine 1
base-de-gomme-naturelle 1*
preparation-a-base-de-pistaches 1*
carotenoides-arome-naturel 1*
farbstoffe 1*
Lait de vache pasteurisé 1
Lactosérum doux en poudre 1
eau-sucre 1*
de:chocoladedragees-met-suikercoating 1*
pszenica 1*
fibra 1*
gianduja 1*
fragrance 1*
traces-eventuellec-de-fruits-a-coque-et-d-anhydride-sulfureux 1*
en:wasabi-en-poudre 1*
glycine-max 1*
cire-vegetale 1*
du-melange-de-13-plan 1*
nei-casi-di-ridotto-apporto-cu-mca-polvere-12-misurino 1*
colorant-carmins 1*
extrait-de-feuilles-d-artichaut 1*
Magnésium 1
E524 1
en:curcumine 1*
acesulfate-k-e950 1*
e-colorant 1*
wheet-flour-sugar-tapioca-starch-corn-star-l 1*
de:huile-de-toumesol 1*
en:butter-oil 1*
extrait-de-graines-de-chardon-marie 1*
en:sel 1*
cornflour 1*
biscuits-souffles-aux-arachides-et-enrobes-au-wasabi-ingrediants-rachide 1*
glansmiedel 1*
aci-e-dre-de-raifort-humectait 1*
orzeszki-ziemne 1*
Vin 1
Sulfate de manganèse 1
en:cocoa-mass 1*
plaats-geenkunstmatige-kleurstoffenenaroma-s 1*
zucker-wasser 1*
Fibres de psyllium 1
glace-a-l-eau-parfum-orange 1*
angelique-confite 1*
aci-ifiant 1*
belgique 1*
huila-da-palma 1*
une-consommation-excessive-peut-des-effets-laxatifs 1*
pate-de-pistache-aromatisee-coloree 1*
Protéines de lait en poudre 1
en:sucre 1*
rindergelatine 1*
arabischo-gomt-schellak 1*
Tégument de psyllium blond 1
extrait-0-2-d-eucalyptus-et-du-melange-de-13-plantes-ricola 1*
gout 1*
concentres-de-plantes 1*
chewy-sweets 1*
Artichaut 1
france-geproduceerd-in-de-europese-unie-voor-csm-benelux-bv 1*
Émulsifiant lécithines 1
arm 1*
E509 1
gingembre-trop-dtamidon-hydrogene-de-tapioca 1*
vegetali 1*
lacti 1*
Potassium 1
arome-naturel-de-truffe-blanche 1*
Pulpe d'orange 1
coloriir-out 1*
fanne-de-seigle 1*
vltamine-bi 1*
Graine de moutarde 1
fromage-dp-surimi 1*
dloeufs 1*
menthe-poivree-gomme-de-xanthane 1*
d-oronge 1*
bromelalne-d-ananas 1*
flijsmidclej 1*
de:kann-spuren-von-schalenfrüchten-und-erdnüssen-sche-enthalten 1*
poudre-dlepinards 1*
une-alimentation-variee-et-ainsi-ou-un-de-vie-sain-sont-import-nts 1*
phosphate-tri-calcique 1*
Sirop de maïs 1
hlatuurlijk-vanillearoma 1*
aina-de-sesame 1*
d-oeuf-rehydrate 1*
proteines-dg-lait 1*
paprikamtractl-verdikkinqsmiddel 1*
corianderlmf 1*
allerg-advice 1*
Vanilline 1
lime-juice-concentrate 1*
mantener-fuera-del-acance-veaquerios 1*
tlatuurlljk-aroma 1*
lt-d-orge 1*
acido-ascorbico 1*
surgele-ingredients-sorbet-pomme 1*
postbus-284 1*
Fumarate ferreux 1
sirop-de-glucose-t-sels 1*
el-50a 1*
nano-emisat-d2-chiorhydrate-de-pyridoxine 1*
en:chlorophylles 1*
creme-edulcorants 1*
mono-et-diglycerides-dlacides-gras 1*
Choline 1
l-cystine 1*
pectine-de-pomme 1*
de:acidity-rejulator 1*
Biscuit 1
tuber-magnatum-pico 1*
couleurs 1*
Sélénite de sodium 1
ingreoients-glace-a-l-eau-parfum-fraise 1*
gelatina-di-manzo 1*
Acide folique 1
triticum-vulgare 1*
Praliné 1
am-don-de-farine-de-seigle 1*
2-salamb-surgeles-ingredients-sucre 1*
chlorophylle-cuivreux 1*
e-de-l-humidite-rition 1*
wasabia-japonical-exhausteurs-de-gout 1*
de:cacaopoeder 1*
gelatine-eau 1*
dark-chocolate-coffee-taste 1*
en:fecule-de-mais 1*
Extrait de poisson 1
chocolat-lait 1*
modifizierte-kartoffelsurke 1*
gelifie 1*
consumir-inmediatamente-despues-de-la-preparacion 1*
vus 1*
maltodextrine-de-cellulose-microcristaline 1*
ii 1*
rijsmiddelen 1*
de:for-allergens-seeingredients-in-bold 1*
amidon-da-mais 1*
ground-coriander 1*
curcuma-dolorant 1*
maltodextrine-da-mais 1*
borrewaterstraat-182 1*
Mélange d'épices 1
sauerungsmittel-farbstoffe 1*
en:copper-chlorophyllin 1*
E160f 1
de-la-lumie 1*
ei 1*
melange-japonais-halange-de-biscuite-souffles-au-ria-at-aux-arachides-ingridiants-ria 1*
Concentrés de fruits 1
de:farine-de-gras-soja 1*
barwniki 1*
olives-eau 1*
sauce-soia-raines-de-e1411-sel-exhaustiuti-otit 1*
Denrée alimentaire colorante 1
Lactose et minéraux du lait 1
mono-et-di 1*
malus-sylv5tr 1*
wasser 1*
nl 1*
a-z 1*
sauce-wasabi 1*
mono-diglycerides-d-acides-gras 1*
de:acide-citrique 1*
kh 1*
en:huile-de-palme 1*
d-ooufs-at-de-uifitax-origins 1*
Extrait de levure en poudre 1
plorant 1*
1*
aroma-s 1*
67802-bischheim-cedex 1*
Manganèse 1
Concentré de jus de pomme 1
e160-c160c-efi 1*
de:pâte-de-cacao 1*
sodium-lauroyl-methyl-isethionate 1*
shea-in-wisselende-verhoudingen 1*
agent-denrobaqe 1*
natriumstearoyl-2-lactvlaat 1*
v 1*
volle-melkpoeder 1*
pistaches-ice-crea-ingredi-weeten-et-mone-gum 1*
E460i 1
carica-papaya 1*
carbonates-dlammonium 1*
de:ri 1*
all-rights-reserved 1*
es:aceite-de-rabano 1*
anthocylnes 1*
huile-essentielle-de-citron-vert 1*
de:kan-sporen-van-pinda-s-en-schaalvruchten-bevatten 1*
difosfaten 1*
curcurmti-acidifiant 1*
protelnes-de-agents-de-charge 1*
bietenrood 1*
Praliné noisettes 1
4600-ag-bergen-op-zoom 1*
pois-wasabi 1*
da-d-celari 1*
zawiera-przeciwutleniaa 1*
extrait-d-eau-de-spiruline 1*
amido-modificato-di-patata 1*
Vinaigre d'eau-de-vie 1
sirop-de-glucoe-e 1*
chlorofylen-en-chlorofylinen 1*
groch 1*
e13-deyc-tindigo-h-chlorophyles-et-chlorophylines 1*
eioo-e120 1*
ninos 1*
E160e 1
schellak 1*
conseil-ycompris-les-cereales-contenant-du-gluten 1*
glycerides-d-acides-gras 1*
de:e341lii 1*
arome-wasa-i 1*
de:camaubawas 1*
caramel-pur-sucre 1*
xaff-lime-leaves-basil 1*
pistaches-pressees-a-froid 1*
sesame-lait-soja 1*
rosemary-leaf 1*
el-71 1*
18-rue-de-ta-robertsau 1*
concentres-de-plantes-spiruline 1*
the-vert-1 1*
bcaa-aminoacidos 1*
ingredienten-farine-de-ble 1*
complexe-cuivre 1*
des-de-fromage-au-basilic 1*
correcteur-d-actdlte 1*
Jus d'ananas 1
citric-adid 1*
arabische-gom 1*
nederland-csm-benelux-n-v 1*
rijsmiddel 1*
Maltodextrine de pomme de terre 1
charbon-vegeetal-medicinal-en-foncdho-du-parfum-du-produit 1*
emodificeerd-aardappelzetmeel 1*
de:e-60c 1*
sa 1*
b 1*
orange-sanguine 1*
Sélénium 1
enniquecidos-com-auni-iamina-b6 1*
zonder-conserveringsmiddelen-sans-matieres-grasses-hydrogenees 1*
de:suiker 1*
Algue marine 1
produit-en-union-europeene-pour-csm-france 1*
2170-merksem 1*
stearoyl-2-lactyiate-de-sod-um 1*
stearoyl-2-lactyiate-de-sodium 1*
extrait-d-epinards 1*
oco 1*
siron-de-innse 1*
melange-non-ogm-de-proteines 1*
pour 1*
x-exauxe 1*
pastilles-de-chocolat 1*
836 1*
ycerldes-d-acides-gras 1*
isomalt-e953 1*
brochette-sapin-poids-net-55g-e-inqredients 1*
vit 1*
sans-glutetu-a-conserver-a 1*
gaultherie 1*
Iodure de potassium 1
Arôme naturel de cassis 1
cubes-de-pomme-greenstar-5mm 1*
acide-pantothenate-de-calcium 1*
dig 1*
Jus d'ananas à base de concentré 1
l 1*
es:aroma-natural-de-eucalipto 1*
palmitate-de-retinyle 1*
Ergocalciférol 1
mentha-viridis 1*
de:ingrediënten 1*
phosphore 1*
pain-kokos 1*
acide-presentation 1*
jus-de-fraise-a-base-de-i-toncentre 1*
anhydrous-fat 1*
or-22-carats 1*
e160a-e160c 1*
cyamopsis-tetragonolobcs 1*
accompagnement 1*
assaisonnement-wasabi 1*
Riz cuisiné 1
lanthaanqom 1*
20-pieces-4-maki-saumon-4-maki-saumon-wakame-4-california-thon-4-california-saumon-4-california-surimi-pesto-sauce-soja 1*
yakino-ri 1*
gingembre-ingredients-sushi-3570 1*
Vinaigre de riz 1
sucre-sel 1*
mu-err 1*
saumon-cru 1*
saumon-salmo-salar-eleve-en-norveae 1*
jus-de-citron-jaune-concentre 1*
huile-de-co-za 1*
e42-eau-sel-huile-de-de-moutarde-maltodex-rine-amidon-de-mais-modine 1*
Crevette 1
meringue-lactee 1*
assortiment-de-16-chocolats-fins 1*
en:colorant 1*
b-e260 1*
thon-eau-sel 1*
Courgette 1
E1519 1
g-ycerol 1*
Brocoli 1
set 1*
mono-diglycerides-d-acides-gras-vegetaux 1*
Jus de citron vert à base de concentré 1
consumare-subito-dopo-aver-preparato-la-miscela-avarte-2-porzione-al-giorno 1*
l-isoleucina 1*
le 1*
wakamef 1*
de:curcumine 1*
Canard 1
Enrobage 1
es:polvo-de-rabano 1*
Huile de sésame 1
watej-gellangom 1*
Crème fraîche liquide 1
mais-n-affecte-en-rien-la-qualite-et-lefet-dupot-sdque-acide-malique 1*
Extrait de baie de sureau 1
e160a-eh-aromatisation-aout 1*
de:totalement-hydrogenée 1*
poudre-de-mo-utarde-amidon-de-mais 1*
clorofilina-e-curcumina 1*
auceso-auce-a-au 1*
sachet-de-gingembre 1*
urtica-dioica 1*
de:d-wafelhoomtjes-gevuld-met 1*
de:zonnebloemolie 1*
Fruit de la passion 1
bioflavonoides-de-citron 1*
extrait-de-prnelle-2-2-acide-aconhique-sodiam 1*
Produit de lactosérum 1
poudre-de-lait-matiere-grasse-vegetale-de-coprah 1*
Parmesan 1
hidrolizado-de-proteinas-de-arroz 1*
poudre-de-lait-ecreme-aromre 1*
algues-dechees 1*
la-proportion-de-est-inferieure-a-la-valuer-del-agent-d-eniobage 1*
tcrta-de-girasol 1*
lecithine-de-soja-colorant 1*
concentre-de-spirulint-concentres-de-fruits-et-de-legumes 1*
chocolaterie-monbana 1*
en:mustard-sesame 1*
poudres-a-ieyer 1*
de:itaandioxide 1*
51 1*
Extrait de fruit 1
de:lécithine-de-soja 1*
cltae-de-hosin-colal-edulcorants 1*
ius-concentre-de-sureau 1*
Lait concentré sucré 1
natuurlljk-aroma 1*
eclats-de-biscuit-amer 1*
feuilles-de-citron-vert 1*
de:schokoladendragées 1*
prima-del-pasto-o-prima-dell-allenamento-e-dopo-lallenamento-o-d-gantegratorn-non-vanno-intesi-come-sostituti-di-una-dieta-variata-ed-equilibrata 1*
extrait-d-eucalyptus-0-2-et-des-13-melange-d-epices-ricola 1*
E150b 1
agentes-de-carga 1*
edgt1-de-caramel-d-isigny 1*
Lait de noix de coco 1
el-20 1*
carte-d-or-a-a-coeur-de-vous-proposer-des-ingredients-de-grande-qualite-tout-en-preservant-la-nature 1*
emulsif-iant 1*
sucre-jus-de-citron-a-base-de-concentre 1*
Concentré de fruits et de plantes 1
eoaa-kplode-powder-complement-alimentaire-a-base-d-acides-amines-a-chaines-ramifiees 1*
dtanhydride-sulfureux 1*
de:natuurlijke-aroma-s 1*
de:graisse-végétale 1*
essefiee-de-fileri-fiv-n 1*
Ortie 1
pate-de-pistache-aromatie-ee-coloree 1*
Pamplemousse 1
zonder-conserveringsmjddelen-grasses-hydrogenees 1*
pepites-citron-vert 1*
Aronie 1
cire-de-carnauba-bha 1*
de:voedi-kochsalz 1*
e-ae-die 1*
arome-de-wasabi 1*
kiwi-puree-with-seeds 1*
issus-de-raisins 1*
ine-pas-avaler 1*
de:agent-d-enrobage 1*
anthocyaninen 1*
Extrait de zeste d'orange 1
arome-de-chanvre 1*
couleurs-naturelles 1*
Mandarine 1
amande-10 1*
sorbet-fraise-8-8-eau 1*
arome-naturel-colorant 1*
sorbet-ananas 1*
du-melange-de-13-plantes-ricola 1*
0-2-d-eucalyptus-et-du-melange-de-13-plantes-ricola 1*
sucra-ose 1*
tes-ricola 1*
Perméat de petit lait 1
essence-de-menthe-poivree 1*
Piments verts 1
contient-do-congelador-lait 1*
olorant 1*
glace-a-l-eau-parfum-citron 1*
cocamidopropyl-betaine 1*
jus-d-orange-a-case-de-concentre 1*
sa-soja 1*
acide-citrique-cobrart 1*
potassium-sorbale 1*
citric-e160c 1*
E124 1
ge-de-betterave 1*
Sirop de sucre mélassé 1
carmini-cun-gusto-del-prodotto 1*
de-fruits-de-matieres-grasses 1*
irinenc 1*
vre 1*
en:dextrose-glucose-syrup 1*
sucre-glucose 1*
Noix 1
Lait stérilisé 1
d-oaufs 1*
acidifiont 1*
de:plantaardig-vet-salz 1*
i330i-imette 1*
naturel 1*
noyau-dlabricot 1*
traces-eventuelles-dloeufs 1*
es03ii 1*
chlorophyle 1*
3-carres-gianduja 1*
chlorophylles-et-chlorophyllines-anthocyanes 1*
cebula-mielona 1*
sodiom-de-carbomethykebe-9elifhiant 1*
ne-pas-depasser-la-dose-ournalie-ateo-lestemmes-enceintes-et-allaitant-ne-doivent-pas-utiliser-ce-produit 1*
Gomme base 1
informations 1*
en:cayenne 1*
information 1*
de:weipoeder 1*
Matière grasse de lait anhydre 1
carbonates-de-sodium-diphosphates 1*
Dextrose de blé 1
nappage-au-sucre 1*
glucose-de-mais 1*
lecithines-de-soja-et-mono-diglycerides-d-acides-gras 1*
dragees-au-chocolat-enrobe-de-sucre-colore 1*
de:cochenille 1*
zonder-geharde-vetten-3-040409-332231-the-simpsons-tm-2016-twentieth-century-fox-film-corporation 1*
mono-en-diglyceriden-van-vetzuren 1*
hrb-bi-au-colorant 1*
oxyde-et-hydroxyde-de-fer-gekleurde-suiker 1*
adde-citrique 1*
dessertcreme-met-chocolade 1*
xiiergenes-signales-en-gras 1*
Fromage blanc 1
Poire 1
fraiche-pasteurisee 1*
230 1*
Rhubarbe 1
gelatina 1*
creme-de-truffe-blanche 1*
en:petits-pois 1*
de:dragées-au-chocolat 1*
Séquestrant 1
voir-les-ingredients-en-gras 1*
assorted-flavour-ingridients 1*
el-62 1*
Arôme naturel d'abricot 1
blanc-d-oeuf-liquide-thermise 1*
algues-ichds-pimant-an-poudre 1*
Sucre glace 1
peut-avoir-des-effets-indesirables-sur-l-activite-et-l-attention-chez-les-enfants 1*
melange-d-extraits-de-plantes-et-de-legumes 1*
Riz basmati 1
grasses-fini 1*
glucides 1*
llg 1*
354kj 1*
de:ingrédients 1*
84kcai 1*
de:rijsmiddel 1*
ceufs-de-plein-air-9-38-pure-sucre-de-canne 1*
kleu-paprika-extract 1*
sojalecithine 1*
Crème dessert au chocolat 1
ssus 1*
E572 1
chlorophyllne-cuitaique 1*
jus-de-lime 1*
pollen-d-abeille 1*
regulator 1*
apres-o 1*
preparee-avec-48-a-daloe-jeneur-totale-vera-vera 1*
E220 1
sirop-de-glucose-de-gelifiant 1*
Arôme naturel de framboise 1
Arôme naturel de poire 1
aromes-naturel-acidifiants 1*
Zestes de citron confits 1
ocide-malique 1*
pulpes-do-fruits-50-6 1*
pulpes-de-fruits-5036 1*
cnu-noepjes 1*
cholorophylles-chlorophyllines 1*
phospha-tri-calcique 1*
pate-de-noix-de-coco 1*
Pulpe de fruits 1
reconocido-en-silimarina 1*
incredients 1*
leite 1*
graines-de-sesarne 1*
e159c-glucose 1*
agent-anti-agglomeration 1*
du-ble-et-dautres-fruitsa-coque 1*
E392 1
fromage-camembert 1*
poudres-a-ever 1*
3-macarons-pistache 1*
le-produit-est-concu-specialement-pour-les-personnes-actives-e-les-sportccocaie-untisation 1*
valeur-nutritive-pour 1*
sorbitotfil-cenne 1*
ij-de-raifort 1*
sucettes-aromes 1*
21-96 1*
feuille-de-soia 1*
chlorophylline-anthocyanes 1*
extrait-de-the-ved 1*
a-pistach-chloroph-excessie-for-allr-may-co-seeds-al-qrillees 1*
hydrolysat-de-proteines-de-riz 1*
petine 1*
cal-product-may-contain-traces-of-wheat 1*
Citron confit 1
Jus de pomme à base de concentré 1
praline-noisettes-ingredients 1*
Noix de muscade 1
E954 1
lus-de-cerise-a-base-de-concentre 1*
Abricot 1
concentrati-vegetali-conservare-in-luogo-e-asciutto 1*
72 1*
extradt 1*
el-72 1*
22-carats 1*
chocolaterie-monbana-p-a 1*
arome-pistache 1*
praline-noi39t-ge 1*
praline-noi3ette 1*
totalement-jarabede-hydrogenee-huile-vegetale-de-palme 1*
chairde-oissons-100 1*
arome-naturel-do-vanille 1*
rrr 1*
caroteno-ide 1*
e3411i 1*
dieses-produkt-kann-spu-ree-die-menge-vol-gluten-unter-der-schwellenwt 1*
chocolat-blcnc-cacao 1*
traces-eventuellz-d-ufs 1*
Riz gluant 1
sell-sesame 1*
natuurlljke-aroma-s 1*
jarabe-de-glucosa 1*
en:palm-and-shea 1*
830 1*
arome-naturel-acidifiant 1*
melange-pour-muffin-americain 1*
de-sesrme-a-soja-et-de-sullites-drigine 1*
carotenoides-et-complexes-cuivres 1*